

Tesamorelin
GHRH Analogue. Supplied in 5 and 10 mg vials, lyophilised and ready to reconstitute.
2 more vials to save 5%
For laboratory research use only. Not for human or veterinary use, and not a medicine, food, or cosmetic. Sold to qualified researchers and institutions.
About Tesamorelin
- Residues
- 44
- Molecular weight
- 5135.9 g/mol
- CAS number
- 218949-48-5
Tesamorelin is a synthetic analogue of human growth hormone-releasing hormone GHRH(1-44) bearing an N-terminal trans-3-hexenoyl group that increases its stability. It acts as an agonist at the GHRH receptor and is used as a research reference compound for GHRH-receptor signalling.
For laboratory research use only. Not for human or veterinary use.
Specifications
- Sequence
- YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
- Molecular formula
- C221H366N72O67S
- Molecular weight
- 5135.9 g/mol
- CAS number
- 218949-48-5
- Form
- Lyophilised powder
- Appearance
- White to off-white powder
- Solubility
- Soluble in bacteriostatic or sterile water
- Storage
- Store the lyophilised powder at -20°C, protected from light. Refrigerate reconstituted material at 2 to 8°C and use within its stability window.
- Purity
- 99.2%
- Lot
- PX-2409-B
- Test date
- May 2026
- Testing lab
- third-party
- Methods
- HPLC, LC-MS/MS
Certificate
Handling and storage
Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
Literature
Published third-party research on this compound, listed for reference. These are the findings of the cited authors, not claims about the material we supply.
- Metabolic effects of a growth hormone-releasing factor in patients with HIVFalutz J, et al. · New England Journal of Medicine · 2007
Common questions about Tesamorelin
- What is Tesamorelin?
- Tesamorelin is a synthetic analogue of human growth hormone-releasing hormone GHRH(1-44) bearing an N-terminal trans-3-hexenoyl group that increases its stability.
- How is Tesamorelin supplied?
- Tesamorelin is supplied as a lyophilised (freeze-dried) powder in 5 mg and 10 mg vials, for laboratory research use only.
- How should Tesamorelin be stored and handled?
- Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
- Has this batch of Tesamorelin been independently tested?
- Yes. Lot PX-2409-B was tested at 99.2% by an independent laboratory. The full certificate of analysis is published and searchable by lot code on the verify page, before and after purchase.
- Is Tesamorelin for human use?
- No. Tesamorelin is supplied strictly for in vitro laboratory research. It is not for human or veterinary use, and is not a medicine, food, or cosmetic.
Frequently combined
Compounds we also offer together as ready-made blends and kits.

Researchers also study
Reconstitution
A measurement aid for laboratory handling. For research use only.
Need the syringe mark, a round-number draw, or a U-40 reading? Open the full calculator with this 5 mg vial loaded.



