How is Tesamorelin supplied?

Tesamorelin is supplied as a lyophilised (freeze-dried) powder in 5 mg and 10 mg vials, for laboratory research use only.

Has this batch of Tesamorelin been independently tested?

Yes. Lot PX-2409-B was tested at 99.2% by an independent laboratory. The full certificate of analysis is published and searchable by lot code on the verify page, before and after purchase.

Is Tesamorelin for human use?

No. Tesamorelin is supplied strictly for in vitro laboratory research. It is not for human or animal consumption, and is not a drug, food, or cosmetic.

Tesamorelin

Name: Tesamorelin
Brand: PepNex
Availability: InStock

GHRH Analogue. Supplied in 5 and 10 mg vials, lyophilised and ready to reconstitute.

Batch certified

UK stock, same-day

Stored cold, shipped & sealed safely

Strength

How many vials?

2 more vials to save 5%

Add bacteriostatic water

Peptides ship as dry powder — you’ll need this to reconstitute the vial.

£60.01 from free UK delivery

Total£39.99

Ships today

Questions about Tesamorelin? Ask us

For laboratory research use only. Not for human or animal consumption, and not a drug, food, or cosmetic. Sold to qualified researchers and institutions.

About Tesamorelin

Residues: 44
Molecular weight: 5135.9 g/mol
CAS number: 218949-48-5

Tesamorelin is a synthetic analogue of human growth hormone-releasing hormone GHRH(1-44) bearing an N-terminal trans-3-hexenoyl group that increases its stability. It acts as an agonist at the GHRH receptor and is used as a research reference compound for GHRH-receptor signalling.

For laboratory research use only. Not for human or veterinary use.

Specifications

HydrophobicPolarAcidicBasic

44 residues

Identity

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
Molecular formula: C221H366N72O67S
Molecular weight: 5135.9 g/mol
CAS number: 218949-48-5

Physical

Form: Lyophilised powder
Appearance: White to off-white powder
Solubility: Soluble in bacteriostatic or sterile water
Storage: Store the lyophilised powder at -20°C, protected from light. Refrigerate reconstituted material at 2 to 8°C and use within its stability window.

This batch

Purity: 99.2%
Lot: PX-2409-B
Test date: May 2026
Testing lab: third-party
Methods: HPLC, LC-MS/MS

Certificate

Certificate · lot PX-2409-B99.2% · HPLC / LC-MS/MS · May 2026

COA · PX-2409-B.pdfIndependent lab report

Handling and storage

Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.

Literature

Metabolic effects of a growth hormone-releasing factor in patients with HIV
Falutz J, et al. · New England Journal of Medicine · 2007

Common questions about Tesamorelin

What is Tesamorelin?: Tesamorelin is a synthetic analogue of human growth hormone-releasing hormone GHRH(1-44) bearing an N-terminal trans-3-hexenoyl group that increases its stability.
How is Tesamorelin supplied?: Tesamorelin is supplied as a lyophilised (freeze-dried) powder in 5 mg and 10 mg vials, for laboratory research use only.
How should Tesamorelin be stored and handled?: Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
Has this batch of Tesamorelin been independently tested?: Yes. Lot PX-2409-B was tested at 99.2% by an independent laboratory. The full certificate of analysis is published and searchable by lot code on the verify page, before and after purchase.
Is Tesamorelin for human use?: No. Tesamorelin is supplied strictly for in vitro laboratory research. It is not for human or animal consumption, and is not a drug, food, or cosmetic.