PNC-27
£39.99
£8.00/mg
FOXO4-DRI
Senolytic Peptide. Supplied in 10 mg vials, lyophilised and ready to reconstitute.
Batch certified
UK stock, same-day
Stored cold, shipped & sealed safely
Strength
How many vials?
2 more vials to save 5%
Add bacteriostatic water
Peptides ship as dry powder — you’ll need this to reconstitute the vial.
£35.01 from free UK delivery
For laboratory research use only. Not for human or animal consumption, and not a drug, food, or cosmetic. Sold to qualified researchers and institutions.
About FOXO4-DRI
- Residues
- 34
FOXO4-DRI is a D-retro-inverso peptide (all D-amino acids in reversed order) designed from the FOXO4 region that interacts with the p53 transactivation domain, engineered to resist proteolysis while preserving binding geometry. In research it is studied as a senolytic tool that perturbs the FOXO4-p53 interaction, promoting p53 nuclear exclusion and apoptosis selectively in senescent cells.
For laboratory research use only. Not for human or veterinary use.
Specifications
HydrophobicPolarAcidicBasic
34 residuesIdentity
- Sequence
- LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP
- Molecular formula
- not recorded
- Molecular weight
- not recorded
- CAS number
- not recorded
Physical
- Form
- Lyophilised powder
- Appearance
- White to off-white powder
- Solubility
- Soluble in bacteriostatic or sterile water
- Storage
- Store the lyophilised powder at -20°C, protected from light. Refrigerate reconstituted material at 2 to 8°C and use within its stability window.
This batch
- Purity
- 98.9%
- Lot
- PX-2427-B
- Test date
- May 2026
- Testing lab
- third-party
- Methods
- HPLC, LC-MS/MS
Certificate
Certificate · lot PX-2427-B98.9% · HPLC / LC-MS/MS · May 2026
Handling and storage
Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
Literature
- Targeted apoptosis of senescent cells restores tissue homeostasis in response to chemotoxicity and ageingBaar MP, et al. · Cell · 2017
Common questions about FOXO4-DRI
- What is FOXO4-DRI?
- FOXO4-DRI is a D-retro-inverso peptide (all D-amino acids in reversed order) designed from the FOXO4 region that interacts with the p53 transactivation domain, engineered to resist proteolysis while preserving binding geometry.
- How is FOXO4-DRI supplied?
- FOXO4-DRI is supplied as a lyophilised (freeze-dried) powder in 10 mg vials, for laboratory research use only.
- How should FOXO4-DRI be stored and handled?
- Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
- Has this batch of FOXO4-DRI been independently tested?
- Yes. Lot PX-2427-B was tested at 98.9% by an independent laboratory. The full certificate of analysis is published and searchable by lot code on the verify page, before and after purchase.
- Is FOXO4-DRI for human use?
- No. FOXO4-DRI is supplied strictly for in vitro laboratory research. It is not for human or animal consumption, and is not a drug, food, or cosmetic.
Researchers also study
Reconstitution
Concentration
5.00 mg/ml
Volume to draw
0.050 ml
On a U-100 syringe
5 units
A measurement aid for laboratory handling. For research use only.
Need the syringe mark, a round-number draw, or a U-40 reading? Open the full calculator with this 10 mg vial loaded.