

PNC-27
p53-Penetratin Peptide. Supplied in 5 mg vials, lyophilised and ready to reconstitute.
2 more vials to save 5%
Peptides ship as dry powder. You need a diluent to reconstitute the vial.
For laboratory research use only. Not for human or veterinary use, and not a medicine, food, or cosmetic. Sold to qualified researchers and institutions.
About PNC-27
- Residues
- 32
- Molecular weight
- 4031.7 g/mol
PNC-27 is a 32-residue chimeric peptide combining the HDM-2 (MDM2)-binding domain of the p53 tumour-suppressor protein with a membrane-residency leader derived from the Drosophila Antennapedia homeodomain. In research it is studied for selective binding to membrane-associated HDM-2 and induction of transmembrane pore formation in transformed cells in vitro.
For laboratory research use only. Not for human or veterinary use.
Specifications
- Sequence
- PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG
- Molecular formula
- C188H293N53O44S
- Molecular weight
- 4031.7 g/mol
- CAS number
- not recorded
- Form
- Lyophilised powder
- Appearance
- White to off-white powder
- Solubility
- Soluble in bacteriostatic or sterile water
- Storage
- Store the lyophilised powder at -20°C, protected from light. Refrigerate reconstituted material at 2 to 8°C and use within its stability window.
- Purity
- 98.5%
- Lot
- PX-2428-C
- Test date
- May 2026
- Testing lab
- third-party
- Methods
- HPLC, LC-MS/MS
Certificate
Handling and storage
Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
Literature
Published third-party research on this compound, listed for reference. These are the findings of the cited authors, not claims about the material we supply.
Common questions about PNC-27
- What is PNC-27?
- PNC-27 is a 32-residue chimeric peptide combining the HDM-2 (MDM2)-binding domain of the p53 tumour-suppressor protein with a membrane-residency leader derived from the Drosophila Antennapedia homeodomain.
- How is PNC-27 supplied?
- PNC-27 is supplied as a lyophilised (freeze-dried) powder in 5 mg vials, for laboratory research use only.
- How should PNC-27 be stored and handled?
- Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
- Has this batch of PNC-27 been independently tested?
- Yes. Lot PX-2428-C was tested at 98.5% by an independent laboratory. The full certificate of analysis is published and searchable by lot code on the verify page, before and after purchase.
- Is PNC-27 for human use?
- No. PNC-27 is supplied strictly for in vitro laboratory research. It is not for human or veterinary use, and is not a medicine, food, or cosmetic.
Researchers also study
Reconstitution
A measurement aid for laboratory handling. For research use only.
Need the syringe mark, a round-number draw, or a U-40 reading? Open the full calculator with this 5 mg vial loaded.
