FOXO4-DRI
£64.99
£6.50/mg
ACTH 1-39
5mg
Research use only
ACTH 1-39
Supplied in 5 mg vials. UK-stocked line, back in soon.
Batch certified
UK stock, same-day
Stored cold, shipped & sealed safely
Out of stock. A certificate of analysis is published with the first batch.
Strength
How many vials?
Out of stock
Not currently available. A certificate of analysis is published with the first batch.
For laboratory research use only. Not for human or animal consumption, and not a drug, food, or cosmetic. Sold to qualified researchers and institutions.
About ACTH 1-39
- Residues
- 39
- Molecular weight
- 4541.1 g/mol
- CAS number
- 12279-41-3
ACTH 1-39 (corticotropin) is the full 39-residue human adrenocorticotropic hormone derived from proopiomelanocortin (POMC). In research it is studied as a melanocortin-2 receptor agonist and as a tool in HPA-axis and steroidogenesis models.
For laboratory research use only. Not for human or veterinary use.
Specifications
HydrophobicPolarAcidicBasic
39 residuesIdentity
- Sequence
- SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
- Molecular formula
- C207H308N56O58S
- Molecular weight
- 4541.1 g/mol
- CAS number
- 12279-41-3
Physical
- Form
- Lyophilised powder
- Appearance
- White to off-white powder
- Solubility
- Soluble in bacteriostatic or sterile water
- Storage
- Store the lyophilised powder at -20°C, protected from light. Refrigerate reconstituted material at 2 to 8°C and use within its stability window.
Certificate
This compound is not currently stocked. Its certificate of analysis, with the independent HPLC and mass-spectrometry results for the batch, is published here when the first lot is released.
Handling and storage
Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
Common questions about ACTH 1-39
- What is ACTH 1-39?
- ACTH 1-39 (corticotropin) is the full 39-residue human adrenocorticotropic hormone derived from proopiomelanocortin (POMC). In research it is studied as a melanocortin-2 receptor agonist and as a tool in HPA-axis and steroidogenesis models.
- How is ACTH 1-39 supplied?
- ACTH 1-39 is supplied as a lyophilised (freeze-dried) powder in 5 mg vials, for laboratory research use only.
- How should ACTH 1-39 be stored and handled?
- Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
- Is ACTH 1-39 for human use?
- No. ACTH 1-39 is supplied strictly for in vitro laboratory research. It is not for human or animal consumption, and is not a drug, food, or cosmetic.
Researchers also study
Reconstitution
Concentration
2.50 mg/ml
Volume to draw
0.100 ml
On a U-100 syringe
10 units
A measurement aid for laboratory handling. For research use only.
Need the syringe mark, a round-number draw, or a U-40 reading? Open the full calculator with this 5 mg vial loaded.