FOXO4-DRI
£64.99
£6.50/mg
LL-37
5mg
Research use only
LL-37
Supplied in 5 mg vials. UK-stocked line, back in soon.
Batch certified
UK stock, same-day
Stored cold, shipped & sealed safely
Out of stock. A certificate of analysis is published with the first batch.
Strength
How many vials?
Out of stock
Not currently available. A certificate of analysis is published with the first batch.
For laboratory research use only. Not for human or animal consumption, and not a drug, food, or cosmetic. Sold to qualified researchers and institutions.
About LL-37
- Residues
- 37
- Molecular weight
- 4493.3 g/mol
- CAS number
- 154947-66-7
LL-37 is the 37-residue C-terminal peptide of the human cathelicidin hCAP18. It is studied as a broad antimicrobial and immunomodulatory peptide in cell and microbiological models, where its amphipathic helix interacts with microbial membranes.
For laboratory research use only. Not for human or veterinary use.
Specifications
HydrophobicPolarAcidicBasic
37 residuesIdentity
- Sequence
- [LL-37, 37 aa]
- Molecular formula
- C205H340N60O53
- Molecular weight
- 4493.3 g/mol
- CAS number
- 154947-66-7
Physical
- Form
- Lyophilised powder
- Appearance
- White to off-white powder
- Solubility
- Soluble in bacteriostatic or sterile water
- Storage
- Store the lyophilised powder at -20°C, protected from light. Refrigerate reconstituted material at 2 to 8°C and use within its stability window.
Certificate
This compound is not currently stocked. Its certificate of analysis, with the independent HPLC and mass-spectrometry results for the batch, is published here when the first lot is released.
Handling and storage
Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
Literature
- The human antimicrobial and chemotactic peptides LL-37 and alpha-defensins are expressed by specific lymphocyte and monocyte populationsAgerberth B, et al. · Blood · 2000
Common questions about LL-37
- What is LL-37?
- LL-37 is the 37-residue C-terminal peptide of the human cathelicidin hCAP18. It is studied as a broad antimicrobial and immunomodulatory peptide in cell and microbiological models, where its amphipathic helix interacts with microbial membranes.
- How is LL-37 supplied?
- LL-37 is supplied as a lyophilised (freeze-dried) powder in 5 mg vials, for laboratory research use only.
- How should LL-37 be stored and handled?
- Reconstitute with bacteriostatic or sterile water. Store the lyophilised powder at -20°C, protected from light; refrigerate reconstituted material at 2 to 8°C. Handle under standard laboratory conditions.
- Is LL-37 for human use?
- No. LL-37 is supplied strictly for in vitro laboratory research. It is not for human or animal consumption, and is not a drug, food, or cosmetic.
Researchers also study
Reconstitution
Concentration
2.50 mg/ml
Volume to draw
0.100 ml
On a U-100 syringe
10 units
A measurement aid for laboratory handling. For research use only.
Need the syringe mark, a round-number draw, or a U-40 reading? Open the full calculator with this 5 mg vial loaded.